English
POU2F3 Antibody - C-terminal region : Biotin
POU2F3 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57992_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3
Molecular Weight: 24kDa
Peptide Sequence: Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: POU domain, class 2, transcription factor 3
Protein Size: 221
Purification: Affinity Purified
Description of Target: This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3
Molecular Weight: 24kDa
Peptide Sequence: Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: POU domain, class 2, transcription factor 3
Protein Size: 221
Purification: Affinity Purified
| Artikelnummer | AVIARP57992_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57992_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 25833 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
