POU2F3 Antibody - C-terminal region : FITC

POU2F3 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57992_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: POU domain, class 2, transcription factor 3

Protein Size: 221

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57992_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57992_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25833
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×