Ppp2r2c Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B gamma isoform

• Artikelnummer: AVIARP57784_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57784_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 269643
• Wirt: Rabbit