Ppp2r3c Antibody - N-terminal region : Biotin

Ppp2r3c Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57063_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Protein Size: 453

Purification: Affinity Purified

Subunit: B''
Mehr Informationen
Artikelnummer AVIARP57063_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57063_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 362739
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×