Ppp3cb Antibody - middle region : HRP

Ppp3cb Antibody - middle region : HRP
Artikelnummer
AVIARP57515_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ppp3cb

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Protein Size: 525

Purification: Affinity Purified

Subunit: beta isoform
Mehr Informationen
Artikelnummer AVIARP57515_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57515_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24675
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×