A2BP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human A2BP1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RNA binding protein fox-1 homolog 1

Protein Size: 370

Purification: Affinity Purified

• Artikelnummer: AVIARP58202_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58202_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54715
• Wirt: Rabbit