ACHE Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE

Key Reference: Johnson,G., (2008) Biochem. J. 411 (3), 507-514

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acetylcholinesterase

Protein Size: 617

Purification: Affinity Purified

• Artikelnummer: AVIARP56761_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56761_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Immunofluorescence, Western Blotting, Immunohistochemistry
• Human Gene ID: 43
• Wirt: Rabbit