AGGF1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain (Tian et al., 2004 [PubMed 14961121]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AGGF1

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Angiogenic factor with G patch and FHA domains 1

Protein Size: 714

Purification: Affinity Purified

• Artikelnummer: AVIARP57098_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57098_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55109
• Wirt: Rabbit