ALOX15 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALOX15

Key Reference: McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arachidonate 15-lipoxygenase

Protein Size: 662

Purification: Affinity Purified

• Artikelnummer: AVIARP56030_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56030_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 246
• Wirt: Rabbit