ANKRD39 Antibody - N-terminal region : Biotin

ANKRD39 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56912_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of ANKRD39 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD39

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 39

Protein Size: 183

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56912_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56912_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51239
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×