ANPEP Antibody

Uniprot: P15144

Gene Name: ANPEP

Immunogen: Recombinant human ANPEP

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 85%

Core Sequence: DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMK

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 83%, Pig - 82%, Cynomolgus monkey - 94%

Alternative gene names: APN；CD13；PEPN

Alternative protein names: Aminopeptidase N; AP-N; hAPN; Alanyl aminopeptidase; Aminopeptidase M; AP-M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; CD antigen CD13

Protein name: Alanyl aminopeptidase,membrane

CD Antigen: CD13

Product panel: IHC Pathology,CD Antigen

Clone No.: K29035_18H9

Antigen Species: Human

Target Name: ANPEP

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-181

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1034-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1034-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Western Blotting
• Isotyp: IgG2a
• Human Gene ID: 290
• Wirt: Mouse
• Konjugat: Unconjugated