Anti-ITGA2B

integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41), Polyclonal, IgG, Rabbit

Artikel in Aktion bis 31. August 2024. Bitte führen sie den Aktionscode Pancer bei der Bestellung an um 15% Rabatt für diesen Artikel zu erhalten.

GeneName: ITGA2B

Enhanced Validation: Yes

Sequence: FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV

Interspecies Mouse/Rat: ENSMUSG00000034664: 77%, ENSRNOG00000022071: 77%

Entrez Gene ID: 3674

UniProt ID: P08514

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000005961

• Artikelnummer: ATLHPA031171-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA031171-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 3674
• Wirt: Rabbit