English
APBB2 Antibody - middle region : HRP
APBB2 Antibody - middle region : HRP
Artikelnummer
AVIARP55624_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APBB2
Key Reference: Hong,Q., (er) BMC Mol. Biol. 8, 50 (2007)
Molecular Weight: 81kDa
Peptide Sequence: Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Amyloid beta A4 precursor protein-binding family B member 2
Protein Size: 736
Purification: Affinity Purified
Description of Target: APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APBB2
Key Reference: Hong,Q., (er) BMC Mol. Biol. 8, 50 (2007)
Molecular Weight: 81kDa
Peptide Sequence: Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Amyloid beta A4 precursor protein-binding family B member 2
Protein Size: 736
Purification: Affinity Purified
| Artikelnummer | AVIARP55624_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55624_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 323 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
