APOL1 Antibody - N-terminal region : Biotin

APOL1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58856_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein L1

Protein Size: 398

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58856_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58856_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8542
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×