APPL1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APPL1

Key Reference: McCrea,H.J., (2008) Biochem. Biophys. Res. Commun. 369 (2), 493-499

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DCC-interacting protein 13-alpha

Protein Size: 709

Purification: Affinity Purified

• Artikelnummer: AVIARP54834_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54834_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26060
• Wirt: Rabbit