ARMC8 Antibody - N-terminal region : Biotin

ARMC8 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56019_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of ARMC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARMC8

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: KVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 8

Protein Size: 659

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56019_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56019_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25852
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×