ATPAF1 Antibody - middle region : FITC

ATPAF1 Antibody - middle region : FITC
Artikelnummer
AVIARP57652_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATPAF1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATP synthase mitochondrial F1 complex assembly factor 1

Protein Size: 328

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57652_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57652_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64756
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×