BANK1 Antibody

BANK1 Antibody
Artikelnummer
ASBKC-1003-100
Verpackungseinheit
100 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: Q8NDB2

Gene Name: BANK1

Immunogen: Recombinant human BANK1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 69%

Core Sequence: PGTMVEGQMERSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNG

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Pig - 79%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: B-cell scaffold protein with ankyrin repeats

Protein name: B cell scaffold protein with ankyrin repeats 1

Clone No.: K92023_4F1

Antigen Species: Human

Target Name: BANK1

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-911

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-1003-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-1003-100
Verpackungseinheit 100 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Immunohistochemistry, Immunocytochemistry
Isotyp IgG1
Human Gene ID 55024
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×