BANK1 Antibody

Uniprot: Q8NDB2

Gene Name: BANK1

Immunogen: Recombinant human BANK1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 69%

Core Sequence: PGTMVEGQMERSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNG

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Pig - 79%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: B-cell scaffold protein with ankyrin repeats

Protein name: B cell scaffold protein with ankyrin repeats 1

Clone No.: K92023_4F1

Antigen Species: Human

Target Name: BANK1

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-911

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1003-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1003-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG1
• Human Gene ID: 55024
• Wirt: Mouse
• Konjugat: Unconjugated