BECN1 Antibody - N-terminal region : FITC

BECN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58873_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BECN1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: PLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beclin-1

Protein Size: 450

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58873_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58873_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8678
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×