BMP6 Antibody - middle region : HRP

BMP6 Antibody - middle region : HRP
Artikelnummer
AVIARP58757_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of deminer

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BMP6

Key Reference: Klink,A., (2008) Blood 111 (12), 5721-5726

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Bone morphogenetic protein 6

Protein Size: 513

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58757_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58757_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 654
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×