BPGM Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BPGM

Key Reference: Wang,Y., (2006) J. Biol. Chem. 281 (51), 39642-39648

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bisphosphoglycerate mutase

Protein Size: 259

Purification: Affinity Purified

• Artikelnummer: AVIARP58217_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58217_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 669
• Wirt: Rabbit