BPNT1 Antibody - N-terminal region : FITC

BPNT1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58597_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BPNT1

Key Reference: Spiegelberg,B.D., (1999) J. Biol. Chem. 274 (19), 13619-13628

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 3'(2'),5'-bisphosphate nucleotidase 1

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58597_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58597_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10380
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×