BXDC2 Antibody - middle region : FITC

BXDC2 Antibody - middle region : FITC
Artikelnummer
AVIARP57201_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BXDC2

Key Reference: 0

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosome biogenesis protein BRX1 homolog

Protein Size: 353

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57201_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57201_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55299
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×