C20orf111 Antibody - N-terminal region : FITC

C20orf111 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56915_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf111

Key Reference: Clerk,A., (2007) Physiol. Genomics 29 (2), 118-127

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C20orf111

Protein Size: 292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56915_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56915_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51526
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×