C22orf28 Antibody - middle region : FITC

C22orf28 Antibody - middle region : FITC
Artikelnummer
AVIARP56746_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf28

Key Reference: Guo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA-splicing ligase RtcB homolog

Protein Size: 505

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56746_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56746_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51493
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×