C2orf3 Antibody - N-terminal region : HRP

C2orf3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58090_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The first mRNA transcript isolated for C2orf3 gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters.The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf3

Key Reference: Anthoni,H., (2007) Hum. Mol. Genet. 16 (6), 667-677

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GC-rich sequence DNA-binding factor 2

Protein Size: 781

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58090_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58090_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6936
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×