C9orf40 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C9orf40 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf40

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: HNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C9orf40

Protein Size: 194

Purification: Affinity Purified

• Artikelnummer: AVIARP57082_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57082_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55071
• Wirt: Rabbit