CARD9 Antibody - middle region : Biotin

CARD9 Antibody - middle region : Biotin
Artikelnummer
AVIARP57704_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CARD9

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase recruitment domain-containing protein 9

Protein Size: 536

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57704_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57704_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64170
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×