CASP7 Antibody - N-terminal region : HRP

CASP7 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58995_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CASP7

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: NNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Caspase-7

Protein Size: 336

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58995_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58995_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 840
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×