CCDC181 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC181

Key Reference: N/A

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 181

Protein Size: 509

Purification: Affinity purified

• Artikelnummer: AVIARP57521_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57521_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57821
• Wirt: Rabbit