CCDC25 Antibody - middle region : Biotin

CCDC25 Antibody - middle region : Biotin
Artikelnummer
AVIARP57178_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC25

Key Reference: 0

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 25

Protein Size: 208

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57178_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57178_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55246
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×