CCDC87 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCDC87

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLARLEWFEGQASNPNRFFKKTNLSSSHFLEENQVRSHLHRKLNLMESS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 87

Protein Size: 849

Purification: Affinity Purified

• Artikelnummer: AVIARP57158_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57158_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55231
• Wirt: Rabbit