Cd247 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Cd247 is a component of T cell receptor (TCR) complex that plays a role in TCR assembly and signaling; It does not promote surface expression of Fc gamma RIII, unlike human homolog.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Cd247

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: ALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 137

Purification: Affinity Purified

• Artikelnummer: AVIARP59100_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59100_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25300
• Wirt: Rabbit