CD38 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD38

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosyl cyclase 1

Protein Size: 300

Purification: Affinity Purified

• Artikelnummer: AVIARP59103_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59103_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 952
• Wirt: Rabbit