CD5 Antibody - N-terminal region : FITC

CD5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58440_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD5

Key Reference: Siderovski,D.P., (2008) J. Mol. Biol. 378 (1), 129-144

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell surface glycoprotein CD5

Protein Size: 495

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58440_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58440_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 921
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×