CD7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq]

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD7

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-cell antigen CD7

Protein Size: 240

Purification: Affinity Purified

• Artikelnummer: AVIARP59112_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59112_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 924
• Wirt: Rabbit