CDC42EP4 Antibody - N-terminal region : FITC

CDC42EP4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54839_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42EP4

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cdc42 effector protein 4

Protein Size: 356

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54839_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54839_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23580
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×