CDCA5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA5

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sororin

Protein Size: 252

Purification: Affinity Purified

• Artikelnummer: AVIARP58263_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58263_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 113130
• Wirt: Rabbit