CDK19 Antibody - C-terminal region : FITC

CDK19 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55155_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK19

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase 19

Protein Size: 442

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55155_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55155_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23097
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×