CFP Antibody - middle region : HRP

CFP Antibody - middle region : HRP
Artikelnummer
AVIARP56382_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CFP

Key Reference: Bathum,L., (2006) Mol. Immunol. 43 (5), 473-479

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Properdin

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56382_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56382_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5199
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×