CHGA Antibody

Uniprot: P10645

Gene Name: CHGA

Immunogen: Recombinant human CHGA

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 82%

Core Sequence: RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 84%, Pig - 86%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Chromogranin-A; CgA; Pituitary secretory protein I; SP-I) [Cleaved into: Vasostatin-1; Vasostatin I; Vasostatin-2; Vasostatin II; EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin; SL21; AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor]

Protein name: Chromogranin A

Product panel: IHC Pathology

Clone No.: K56007_3G5

Antigen Species: Human

Target Name: CHGA

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-153

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1021-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1021-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation, Western Blotting
• Isotyp: IgG1
• Human Gene ID: 1113
• Wirt: Mouse
• Konjugat: Unconjugated