English
CHMP4C antibody
CHMP4C antibody
Artikelnummer
GTX04627-100
Verpackungseinheit
100 μl
Hersteller
GeneTex
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Calculated MW: 26
Form: Liquid
Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Antigen Species: Human
Immunogen: A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Form: Liquid
Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Antigen Species: Human
Immunogen: A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
| Artikelnummer | GTX04627-100 |
|---|---|
| Hersteller | GeneTex |
| Hersteller Artikelnummer | GTX04627-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 μl |
| Mengeneinheit | STK |
| Reaktivität | Mouse (Murine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Isotyp | IgG |
| Human Gene ID | 66371 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
