CNDP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNDP2

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic non-specific dipeptidase

Protein Size: 475

Purification: Affinity Purified

• Artikelnummer: AVIARP57168_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57168_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55748
• Wirt: Rabbit