CNPY3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNPY3

Molecular Weight: 31

Peptide Sequence: Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein canopy homolog 3

Protein Size: 278

Purification: Affinity Purified

• Artikelnummer: AVIARP57944_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57944_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10695
• Wirt: Rabbit