Cpne2 Antibody - N-terminal region : FITC

Cpne2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55509_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cpne2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copine-2

Protein Size: 548

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55509_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55509_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 234577
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×