CPXM1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPXM1

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable carboxypeptidase X1

Protein Size: 734

Purification: Affinity Purified

• Artikelnummer: AVIARP57346_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57346_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56265
• Wirt: Rabbit