CTSS Antibody

Uniprot: P25774

Gene Name: CTSS

Immunogen: Recombinant human CTSS

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 81%

Core Sequence: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Cathepsin S

Protein name: Cathepsin S

Clone No.: K29028_14G7

Antigen Species: Human

Target Name: CTSS

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: Fail (HL-60)

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-1683

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1022-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1022-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Western Blotting
• Isotyp: IgG2a
• Human Gene ID: 1520
• Wirt: Mouse
• Konjugat: Unconjugated