CUTC Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CUTC

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Copper homeostasis protein cutC homolog

Protein Size: 273

Purification: Affinity Purified

• Artikelnummer: AVIARP56791_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56791_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51076
• Wirt: Rabbit