English
CYP4X1 Antibody - middle region : Biotin
CYP4X1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55763_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4X1
Key Reference: Savas,U., (2005) Arch. Biochem. Biophys. 436 (2), 377-385
Molecular Weight: 59kDa
Peptide Sequence: Synthetic peptide located within the following region: LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cytochrome P450 4X1
Protein Size: 509
Purification: Affinity Purified
Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4X1
Key Reference: Savas,U., (2005) Arch. Biochem. Biophys. 436 (2), 377-385
Molecular Weight: 59kDa
Peptide Sequence: Synthetic peptide located within the following region: LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cytochrome P450 4X1
Protein Size: 509
Purification: Affinity Purified
| Artikelnummer | AVIARP55763_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55763_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 260293 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
