DDAH1 Antibody - middle region : Biotin

DDAH1 Antibody - middle region : Biotin
Artikelnummer
AVIARP54852_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Sequence Note: AB001915.1 is a chimeric sequence. Only the DDAH1 region was propagated into this RefSeq record. [6/17/03, RefSeq staff]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDAH1

Key Reference: Kim,Y.J., (2008) Twin Res Hum Genet 11 (1), 77-83

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

Protein Size: 285

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54852_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54852_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 23576
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×